Protein Info for MMJJ_RS00890 in Methanococcus maripaludis JJ

Annotation: coenzyme F420 hydrogenase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR03294: coenzyme F420 hydrogenase, subunit gamma" amino acids 2 to 242 (241 residues), 335.3 bits, see alignment E=1e-104 PF01058: Oxidored_q6" amino acids 12 to 153 (142 residues), 105.5 bits, see alignment E=3.4e-34 PF13237: Fer4_10" amino acids 183 to 230 (48 residues), 33.7 bits, see alignment 5.7e-12 PF00037: Fer4" amino acids 184 to 206 (23 residues), 30 bits, see alignment (E = 6.6e-11)

Best Hits

Swiss-Prot: 86% identical to FRHG_METVO: Coenzyme F420 hydrogenase subunit gamma (frhG) from Methanococcus voltae

KEGG orthology group: K00443, coenzyme F420 hydrogenase gamma subunit [EC: 1.12.98.1] (inferred from 99% identity to mmp:MMP0818)

Predicted SEED Role

"Coenzyme F420 hydrogenase gamma subunit (FrcG) (EC 1.12.98.1)" in subsystem Coenzyme F420 hydrogenase (EC 1.12.98.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.98.1

Use Curated BLAST to search for 1.12.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>MMJJ_RS00890 coenzyme F420 hydrogenase subunit gamma (Methanococcus maripaludis JJ)
MVRVAHIHMSGCTGCLISLTDTYEKLLDILGAVELVYALTLADEKTEITETDDKILIERK
IPENIDIALVEGSVCLDDHHSVEDILTTRKNSKIVVALGACAASGGVTRFGRGGQMSQPS
HSSFVPIGDVIKVDLALPGCPPSTESIVNLIMAALNGDMDYLEPFAEIAKYGKDACGCDV
IKNVIDQSLCMGCGTCAAACQVKAIEMIEGKPNIMTEFCIKCGICGAQCPRVRFPELVQK
IE