Protein Info for MMJJ_RS00865 in Methanococcus maripaludis JJ

Annotation: Ni/Fe hydrogenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF00374: NiFeSe_Hases" amino acids 39 to 115 (77 residues), 82.4 bits, see alignment E=1.9e-27 amino acids 236 to 448 (213 residues), 41.3 bits, see alignment E=5.4e-15

Best Hits

Swiss-Prot: 83% identical to VHCA_METVO: F420-non-reducing hydrogenase vhc subunit A (vhcA) from Methanococcus voltae

KEGG orthology group: K14126, F420-non-reducing hydrogenase subunit A [EC: 1.12.99.-] (inferred from 99% identity to mmp:MMP0823)

Predicted SEED Role

"CoB--CoM-reducing hydrogenase (Cys) alpha subunit" in subsystem H2:CoM-S-S-HTP oxidoreductase

Isozymes

Compare fitness of predicted isozymes for: 1.12.99.-

Use Curated BLAST to search for 1.12.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>MMJJ_RS00865 Ni/Fe hydrogenase subunit alpha (Methanococcus maripaludis JJ)
MTKLSIEPVTRVEGHGKVTLSFDDSGKLDKVNFHVVEVRGFEKFLEGRYIEDAPVFTPRI
CGICQVSHNLASARAVDNVFGVKIPKTADMLRNLMQQASNVHSHALHFGMLASPDLMFPM
TDDALKRNVLGVAAENMDVVKDAISMRKIGQTIIQKVGGRAIHPVTAVVGGQSKPLTEEE
RDELLKMSENLVDTAERTLVVGKQLLDGLKEQNLLELGYFESYHMGMVNNGAQDIYEGKI
RVINPEGKIEYEYEPSEYLNYMSEGVRPYSYLKFPYLTEKGPVDGVYRVNTLSRLNVCDK
MPTPIAQKYYEEFVKTFGKPAHHPMLFHYARLIELISSAELIRKFLEDDAIVGTDIRVEP
TDLVGEGVGCLEAPRGTLVHHFKTDDKGIITDANLVVATVQNNPAMDIGVQKVAEKYIKT
PEDAKPHVLNHMEMVIRAYDPCLSCATHTIDGKERMLSMDVYKGGKLIKTL