Protein Info for MMJJ_RS00580 in Methanococcus maripaludis JJ

Annotation: 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit CofG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR03550: 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit" amino acids 36 to 350 (315 residues), 484.1 bits, see alignment E=9.2e-150 PF04055: Radical_SAM" amino acids 43 to 214 (172 residues), 44.2 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 92% identical to COFG_METM7: 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase (cofG) from Methanococcus maripaludis (strain C7 / ATCC BAA-1331)

KEGG orthology group: K11780, FO synthase subunit 1 [EC: 2.5.1.77] (inferred from 96% identity to mmp:MMP0876)

MetaCyc: 69% identical to 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 1 (Methanocaldococcus jannaschii)
RXN-19230 [EC: 4.3.1.32]

Predicted SEED Role

"7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 1" in subsystem Coenzyme F420 synthesis

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.77

Use Curated BLAST to search for 2.5.1.77 or 4.3.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>MMJJ_RS00580 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit CofG (Methanococcus maripaludis JJ)
MITKSEALDFLKSNSTNSILEKLGKINAENTSKYVTFSKNAFIPVCNWCRNVCGYCTFRN
ENFKLLKMDEMKEILTKADTFGCREALFTFGENVDENEKVKEELKKMGYSGILEYLYEIS
AWCLENTNLLPHTNCGILSYDELKYLREVNASMGLMLENSSARLCGTIAHEKSPGKDPNL
RIEMIENAGKLKIPFTTGILIGIGETLEERIDSIFEIKRIYEKYGHIQEVIVQNFRSKPQ
IPMENYREPSPIEMFKMIILSKLILDDISIQVPPNLNRETGQLFLMAGIDDWGGVSPLTK
DFVNPEAPWPDIEELNSFSKELGYTLKERLPVYEKYITKEWIDKKILEKINK