Protein Info for MMJJ_RS00370 in Methanococcus maripaludis JJ

Annotation: asparagine synthase (glutamine-hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01536: asparagine synthase (glutamine-hydrolyzing)
  • amino acids 2 to 390 (389 residues), 294 bits, E=1.3e-91
• PF13522: GATase_6
  • amino acids 69 to 181 (113 residues), 107.7 bits, E=6.8e-35
• PF13537: GATase_7
  • amino acids 74 to 185 (112 residues), 108 bits, E=4.5e-35
• PF00733: Asn_synthase
  • amino acids 249 to 389 (141 residues), 112 bits, E=7.6e-36
  • amino acids 390 to 482 (93 residues), 78.4 bits, E=1.3e-25

Best Hits

KEGG orthology group: K01953, asparagine synthase (glutamine-hydrolysing) [EC: 6.3.5.4] (inferred from 98% identity to mmp:MMP0918)

Predicted SEED Role

"Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)" in subsystem Cyanophycin Metabolism or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 6.3.5.4)

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-asparagine biosynthesis I (1/1 steps found)
• L-glutamine degradation I (1/1 steps found)
• superpathway of L-asparagine biosynthesis (1/2 steps found)
• L-citrulline biosynthesis (4/8 steps found)
• L-glutamate and L-glutamine biosynthesis (3/7 steps found)
• superpathway of L-citrulline metabolism (6/12 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.4

Protein Sequence (513 amino acids)

>MMJJ_RS00370 asparagine synthase (glutamine-hydrolyzing) (Methanococcus maripaludis JJ)
MCSISGIIAKDEEGSGSRSLLKNIQKHVINMMKILKHRGPDYSGMMFDDEVLYFENFDDI
TENTETISRMAMGHNRLAIVGTAVQPIPNTDESIWIICNGEIYNHVELRDELSVEHEFKT
DTDSEAIIHAYEDELVDVLDGDYAYAIYDKEKNIIELRRDLMGVKPLYYIDMDEYFAFAS
EKKALYYLLMEINEMDYKSAFNYDISRLNPNSRLVYELDENSWYIEEDLEKVNPDYFEEN
DYELCKNELETTILDSVLKRVNGLERVGIIYSGGVDSTLISKLASENCDVTLYSVGSENS
EDLIYAERAAKDMGLNFRKKIILEDEFEEYVIKVAKAIDELDVMKLSVGIPIFAASEMAK
EDGIKVVLSGQGADELFAGYNRYQRILNEKGEEGLKKSIISDVFDIHKVNLERDDHCTMA
NGVELRVPFLDKFVIDVGLSIPVEYKIEEPRKKILRDIASKYVPDYIAQRPKKAAQYGSG
SEKMVYAVAKKHGYSKKEINKFFEEYLIEKIKF