Protein Info for MMJJ_RS00200 in Methanococcus maripaludis JJ

Annotation: translation initiation factor IF-5A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00037: translation elongation factor IF5A
  • amino acids 2 to 128 (127 residues), 155.5 bits, E=3.1e-50
• PF21485: IF5A-like_N
  • amino acids 4 to 63 (60 residues), 61.8 bits, E=6.7e-21
• PF01287: eIF-5a
  • amino acids 71 to 127 (57 residues), 25.7 bits, E=1.6e-09

Best Hits

Swiss-Prot: 99% identical to IF5A_METMP: Translation initiation factor 5A (eif5a) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03263, translation initiation factor 5A (inferred from 99% identity to mmp:MMP0952)

Predicted SEED Role

"Eukaryotic translation initiation factor 5A" in subsystem Translation initiation factors eukaryotic and archaeal

Protein Sequence (131 amino acids)

>MMJJ_RS00200 translation initiation factor IF-5A (Methanococcus maripaludis JJ)
MAGTKPSELGALKVGQYVVIDGIACRVMDTAHSKPGKHGGAKVRLTAMGIFEPVKKEHVG
PASSRIDVPLIDKRKGQVLALMGDHVQIMDLETYETLELPMPTDVEGIDSGVEVEYFEAM
DRYKITRVISK