Protein Info for MMJJ_RS00120 in Methanococcus maripaludis JJ

Annotation: histidinol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 PF00815: Histidinol_dh" amino acids 19 to 423 (405 residues), 555.3 bits, see alignment E=4.6e-171 TIGR00069: histidinol dehydrogenase" amino acids 32 to 422 (391 residues), 534 bits, see alignment E=1.3e-164

Best Hits

Swiss-Prot: 98% identical to HISX_METMP: Histidinol dehydrogenase (hisD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00013, histidinol dehydrogenase [EC: 1.1.1.23] (inferred from 98% identity to mmp:MMP0968)

Predicted SEED Role

"Histidinol dehydrogenase (EC 1.1.1.23)" in subsystem Histidine Biosynthesis (EC 1.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>MMJJ_RS00120 histidinol dehydrogenase (Methanococcus maripaludis JJ)
MIVKKISKLNEKELDIILNRNKTNISGILPTVSEILENVQKNGDNALKEYTKKFDGVNLD
NFKVSSEEIDKAYDKIDSKVVESLEKAYENIKEFHEIQFKNLNEWEIEKKGIKAGQIIRP
VEKAGCYVPGGRAFYPSTVLMTVTPAKVAGVKEVIVTSPPNGTEGNPATLVASDIAKADG
IYKIGGAQAIGALAYGTKSIPKVDIIVGPGNIFVTAAKKLVYGEVSIDFPAGPSEVLIMC
DESSNEEYVAMDFLAQAEHDPNASCIITVTSEEKAEKIKERILMEIKTAKRTEIIEKSIL
NSAIVIGSIEECIELSNSYAPEHLEIMTKNPREVLKSIENAGSIFLGNYAPVPVGDYASG
TNHVLPTSACAKMYSGLSVETFIKKPTVQELTKEGLLGISDIVTTLAEAEGLFNHSEAVK
RRLN