Protein Info for MMJJ_RS00055 in Methanococcus maripaludis JJ

Annotation: CO dehydrogenase/acetyl-CoA synthase subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 330 to 350 (21 residues), see Phobius details TIGR00381: CO dehydrogenase/acetyl-CoA synthase, delta subunit" amino acids 5 to 381 (377 residues), 622.3 bits, see alignment E=1.4e-191 PF03599: CdhD" amino acids 74 to 316 (243 residues), 271.4 bits, see alignment E=5.6e-85

Best Hits

Swiss-Prot: 72% identical to ACDD_METTH: Acetyl-CoA decarbonylase/synthase complex subunit delta (cdhD) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00194, acetyl-CoA decarbonylase/synthase complex subunit delta (inferred from 98% identity to mmx:MmarC6_1677)

Predicted SEED Role

"CO dehydrogenase/acetyl-CoA synthase subunit delta, corrinoid iron-sulfur subcomplex small subunit" in subsystem Carbon monoxide induced hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>MMJJ_RS00055 CO dehydrogenase/acetyl-CoA synthase subunit delta (Methanococcus maripaludis JJ)
MDTMSQILKLLEKTDSIEINEFRMDVDELELTIMPTLQNVVQKVVEKQIEAKKEFESQIE
FKYPVKDYAGKVNEVKLGGKNRKTVKLGGQTSLYRFEEPQPNAPTVTFDVFDIPMNGLPR
PIKENFEDVMHSPGEWAEKAVKEFGADMITLHLIGTDPKVKDKSLKDAAKDLEEVLQAVK
VPLVIGGSGNPKKDPLVLEMAAEVADGERCLLASANLDLDYQKIAQAAVKHDHAVLSWAI
SDINMQKVLNKALMKEGLTANDIVMDPTTCALGYGIEFSIDVMTRTRLSALKGEEILQMP
MSSGTTNAWGSREAWMKKDEWGPTKYRGPIWEVVTGLTMMLCGVDIFMMLHPLSVKTLKE
IGTTLTYEYKSKESQDLSDWITKF