Protein Info for LRK55_RS18705 in Rhodanobacter denitrificans MT42

Annotation: Cu(I)-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF00376: MerR" amino acids 20 to 57 (38 residues), 48.8 bits, see alignment E=7.1e-17 PF13411: MerR_1" amino acids 20 to 86 (67 residues), 54.2 bits, see alignment E=1.9e-18 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 21 to 144 (124 residues), 156.5 bits, see alignment E=1.8e-50 PF09278: MerR-DNA-bind" amino acids 62 to 126 (65 residues), 77.5 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 60% identical to Y4778_PSEAE: Uncharacterized HTH-type transcriptional regulator PA4778 (PA4778) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 62% identity to psu:Psesu_1567)

Predicted SEED Role

"Cu(I)-responsive transcriptional regulator" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>LRK55_RS18705 Cu(I)-responsive transcriptional regulator (Rhodanobacter denitrificans MT42)
MPRPALRPEAADARALGLHTIGEAALASAVTAKMIRHYESIGLMPTAGRTFAGYRLYAES
DLHRLRFIKRARTLGFSIKEIEQLLSLWDDRQRASSEVKQLALQHARALEQKIREMESMR
ATLTDLARRCHGDNHPDCPILEDLAGTSRKATN