Protein Info for LRK55_RS17365 in Rhodanobacter denitrificans MT42

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details PF00892: EamA" amino acids 148 to 277 (130 residues), 66.2 bits, see alignment E=1.7e-22

Best Hits

KEGG orthology group: None (inferred from 65% identity to pmk:MDS_2248)

Predicted SEED Role

"Putative DMT superfamily metabolite efflux protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>LRK55_RS17365 EamA family transporter (Rhodanobacter denitrificans MT42)
MSSRSTVAPLALAVGMLLVSMVSYQCGASLAKHLFPLVGAQGATAYRLGLSALLLLLWRR
PWRHAGRRDWRALWGYGLAMGAMNLVFYLSLRTIPLGIAVALEFTGPLALALFGSRRWLD
FVWIALVVAGLALLLPLRGQLHALDPVGVMYALAAGAGWALYIVLGKKAGATHGADAVTL
GTSIGALLAIPFGIAHAGSALLSPALLPYALGVAVLSSALPYSLEMVALTRLPARTFSTL
LSLEPAIAAVAGVALLGERLSLLQWLAIATIIVAAAGTALSVQRPALAEPLAN