Protein Info for LRK55_RS15670 in Rhodanobacter denitrificans MT42

Annotation: RluA family pseudouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 23 to 38 (16 residues), see Phobius details PF00849: PseudoU_synth_2" amino acids 96 to 243 (148 residues), 93.1 bits, see alignment E=1.1e-30

Best Hits

KEGG orthology group: None (inferred from 68% identity to psb:Psyr_2133)

Predicted SEED Role

"Similar to ribosomal large subunit pseudouridine synthase A" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>LRK55_RS15670 RluA family pseudouridine synthase (Rhodanobacter denitrificans MT42)
MDPSTPSFSRDPRASTVHLPPGAWVTVLDGLCALFGAIDRAQWLDRIARGRVLDGQGIAI
TPQTPYRPGMCIHYYREVADERPIPFVEAVLHADAHLVVADKPHFLPVTPAGGFVEQTLL
RRLMHRLGNSDLVPLHRIDRATAGLVLFSANPASRAAYQALFRERRIDKRYEALAPPLPS
LAFPLSRRSRIVAGEPFFRMREVDGEPNSETRIEPIGRGEDAWRYALFPVSGRKHQLRVH
MAALGAPIVGDTLYPALADKSADDHAQPLKLLARSLTFVDPLSGERRHFESRLAL