Protein Info for LRK55_RS14775 in Rhodanobacter denitrificans MT42

Annotation: RNA polymerase sigma factor SigJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 6 to 159 (154 residues), 69.4 bits, see alignment E=1.4e-23 PF04542: Sigma70_r2" amino acids 7 to 71 (65 residues), 54.6 bits, see alignment E=1.1e-18 PF08281: Sigma70_r4_2" amino acids 107 to 157 (51 residues), 56.1 bits, see alignment 3.4e-19 PF04545: Sigma70_r4" amino acids 110 to 159 (50 residues), 32.5 bits, see alignment 7.4e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 48% identity to bph:Bphy_6641)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>LRK55_RS14775 RNA polymerase sigma factor SigJ (Rhodanobacter denitrificans MT42)
MDPQTALFQQHRQRLFGLAYRMLGTPSDAEDVLHDAWLRWHAQDTDALDDPEAWLVTVTT
RIALDRLRRAKTERAHYAGPWLPEPLTVDADQPEAQLERAESLTLTFLLLLERLSAEERA
AFLLREVFDYSHAETAAMLEISEDACRQRVHRAKQRLREDRPRQAMPNIDTQRRLLERFM
QALQQPDMPTLRALFAEDAMSVSDGGGLARAILHPLHGAERLARLYMQIALQQQRHGGVR
YEIHQLNGMPALFGWHGDTLISASWIDDDGERITAVHALRHPGKLARLAAVTKSAASTSL
H