Protein Info for LRK55_RS14000 in Rhodanobacter denitrificans MT42

Annotation: nitrous oxide reductase accessory protein NosL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF05573: NosL" amino acids 35 to 166 (132 residues), 132.9 bits, see alignment E=4.5e-43

Best Hits

Predicted SEED Role

"Nitrous oxide reductase maturation protein, outer-membrane lipoprotein NosL" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>LRK55_RS14000 nitrous oxide reductase accessory protein NosL (Rhodanobacter denitrificans MT42)
MHPLPLTVIRRAGFMLALVLLAGCSGHPSPAKPAVDTHADDTCAVCGMYLDGSPGPRAEA
WVSGRAKPLVFDSTRDFFAYVLQPENLSALQELYVQDSARIDWQQPSHAAVSFIDARRAY
YVAWQPLPGSMGPTLAPFASHAAAETFVREHGGAVLAFDEVTPALVATLDYRCPAQAAGR
HGAPQCLAPAAPSLGLSAHPQPAFPPASPPPPAHPHPHP