Protein Info for LRK55_RS12985 in Rhodanobacter denitrificans MT42

Annotation: ThiF family adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 75 to 96 (22 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF00899: ThiF" amino acids 57 to 308 (252 residues), 137 bits, see alignment E=2.8e-44

Best Hits

KEGG orthology group: None (inferred from 65% identity to tkm:TK90_2502)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>LRK55_RS12985 ThiF family adenylyltransferase (Rhodanobacter denitrificans MT42)
MSSQRRRPNVRQCFQASRCCRPGSATALSSKVESRCLMMSDAPVTPEPFDYATAFSRTIG
WITRAEQAKLRSRRVAIAGLGGVGGSHLLTLTRLGIQSFNLADLDRFGTENFNRQAGAFL
STVGQPKVDVVSRMARDINPDLDINKFPGGVTVDNMEQFLSGVDLYVDGLDFFVLDIRAR
LFALCAERGIPAITAAPLGMGAAVLVFLPGQMTFEEYFRLEGKTLDEQLLRFMVGLAPAV
LHQGYLVDPSAVDLVNHRGPSTPMACEICAGIAGTQALKILLGRGKVLAAPHGLHFDAYR
NKLARTWRPGGNNNPLQRLLLSVARRRFMRR