Protein Info for LRK55_RS12770 in Rhodanobacter denitrificans MT42

Annotation: alpha-amylase family glycosyl hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00128: Alpha-amylase" amino acids 57 to 378 (322 residues), 291.2 bits, see alignment E=1.5e-90 PF11941: DUF3459" amino acids 428 to 515 (88 residues), 24 bits, see alignment E=4.4e-09

Best Hits

KEGG orthology group: None (inferred from 56% identity to pjd:Pjdr2_0774)

Predicted SEED Role

"Alpha-amylase (EC 3.2.1.1)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Biosynthesis (EC 3.2.1.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (517 amino acids)

>LRK55_RS12770 alpha-amylase family glycosyl hydrolase (Rhodanobacter denitrificans MT42)
MIRRLLTSMLLALSALASGGFAPALAAPAAPAASAPSGVWYEIFVRSWVDTNGDGIGDLN
GVTAKLDYLKSLGVSGIWLMPINPSPTYHGYDITDYYAINPQYGSMADFERLLREAHKRS
IKVIIDLVINHTSNQHPWFKAARDPADPHHDWYSWAGPHTDLHAEDAAGAQAWHALGKAH
YLGDFSREMPDLDYDTPAVRREMVKLGQYWLKKGVDGFRLDAAQHIYYDFKADIHNPLTL
QKNLAWWSEFRRGLDQVNPAAYVVGEVTRDSADELAPYFKPLSAVFDFPLAVQLIDSARS
ERAGDLGALLAHTDAAYRQVAGRSGVDAPFLSNHDQERVMSQLGGNPQHMRMAAAMLLTL
PGQPFVYYGEELGMRGRKPDPDLREPMRWNRVPDAPGETTWKSFTAHDGPQVSVEAQQAD
ADSLLHYYSMLIHWRSELPALRDGAIRPWISDNPHIAAWQLDDAHGRMLVVHNLSGQPQS
LALDGQPFHRVRLRSGPGATVQHERLQLPAYTTAILQ