Protein Info for LRK55_RS12605 in Rhodanobacter denitrificans MT42

Annotation: BolA/IbaG family iron-sulfur metabolism protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 79 PF01722: BolA" amino acids 24 to 74 (51 residues), 65 bits, see alignment E=2.9e-22

Best Hits

Swiss-Prot: 44% identical to Y3122_SYNY3: Uncharacterized protein ssr3122 (ssr3122) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 74% identity to smt:Smal_0960)

Predicted SEED Role

"Cell division protein BolA" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (79 amino acids)

>LRK55_RS12605 BolA/IbaG family iron-sulfur metabolism protein (Rhodanobacter denitrificans MT42)
MDPARIQAMIENGLPGARVEVGGADGVHFEATVVASQFAGKLPLARHRLVYATLGEQMGG
AIHALALKTLTPEEAGNRE