Protein Info for LRK55_RS12475 in Rhodanobacter denitrificans MT42

Annotation: CDF family Co(II)/Ni(II) efflux transporter DmeF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 23 to 314 (292 residues), 203.8 bits, see alignment E=1.7e-64 PF01545: Cation_efflux" amino acids 30 to 242 (213 residues), 122.9 bits, see alignment E=7.7e-40

Best Hits

KEGG orthology group: None (inferred from 67% identity to ppf:Pput_4528)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>LRK55_RS12475 CDF family Co(II)/Ni(II) efflux transporter DmeF (Rhodanobacter denitrificans MT42)
MPAPDIAPFIHSHQFNHIDAKAERNTRHVVFITAAMMVVEIVGGYWLNSMALLADGWHMS
SHALAMGLSVMAYVLARRYAKDGRFAFGTWKIEILGGYSSALLLAVVAALMMVQSLERLF
VPAAIQYDDAILIAVLGLGVNLLCAWLLKGEHPHEHGHAHGPDHGHAHGHGHAGHRHHDV
NLRAAYLHVIADAATSVLAIVALVGGKLYGAAWLDPAMGIVGSVLVARWAWGLLRESGRI
LLDAEMDQPVVEEIRDVVRQRFTTAAVSDLHVWRVGRDSYACILGLVASSAIRAEDVRRE
LAIHEELVHVTVEVAVA