Protein Info for LRK55_RS11615 in Rhodanobacter denitrificans MT42

Annotation: O-acetyl-ADP-ribose deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF01661: Macro" amino acids 19 to 137 (119 residues), 150.8 bits, see alignment E=8e-49

Best Hits

Swiss-Prot: 62% identical to Y2219_CHLTE: Macro domain-containing protein CT2219 (CT2219) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

KEGG orthology group: None (inferred from 62% identity to cte:CT2219)

Predicted SEED Role

"COG2110, Macro domain, possibly ADP-ribose binding module"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>LRK55_RS11615 O-acetyl-ADP-ribose deacetylase (Rhodanobacter denitrificans MT42)
MPIKVIHADITRLAPDAIVNAANSGLLGGGGVDGAIHRTAGPALLKACRALPEIAPGVRC
PIGEARITPGFALPARWVIHTVGPVWHGGDEGEAELLARCHRNALRLLRERALRTIAFPA
ISCGVYGYPAAQAAAVAVATLRDALAAADDDIEVTLCCFSDAMRAVFQQALAP