Protein Info for LRK55_RS11565 in Rhodanobacter denitrificans MT42

Annotation: PilN domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details PF05137: PilN" amino acids 100 to 176 (77 residues), 65.3 bits, see alignment E=2.1e-22

Best Hits

Predicted SEED Role

"Type IV pilus biogenesis protein PilN" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>LRK55_RS11565 PilN domain-containing protein (Rhodanobacter denitrificans MT42)
MAHVNLLPWRVARRKQREREFYMQLAAAFVAGLGVLLLWVFWMDQRIDNQNDRNTYLQTE
IKQLDVRIAKIKDLEKVREHLLARKQIIEQLQADRSQMVHLFDELVKTIPASARLSGLKQ
NGQSMSLDGVAQSNASVAEYMRNIEGSPWMGHADLRKTENTHNGSRMPYVFGLNVTLSKP
KADEADGKTPVLPNAAGTAAASTAPAAAAKAATASPAKPAATTAPEAKPVSAPAATGGAR
S