Protein Info for LRK55_RS11320 in Rhodanobacter denitrificans MT42
Annotation: adenosylmethionine decarboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 84% identical to SPED_XANAC: S-adenosylmethionine decarboxylase proenzyme (speD) from Xanthomonas axonopodis pv. citri (strain 306)
KEGG orthology group: K01611, S-adenosylmethionine decarboxylase [EC: 4.1.1.50] (inferred from 86% identity to psu:Psesu_0328)MetaCyc: 62% identical to S-adenosylmethionine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50), prokaryotic class 1A" in subsystem Polyamine Metabolism (EC 4.1.1.50)
MetaCyc Pathways
- L-methionine salvage cycle III (10/11 steps found)
- spermidine biosynthesis I (2/2 steps found)
- L-methionine salvage cycle I (bacteria and plants) (9/12 steps found)
- superpathway of polyamine biosynthesis II (6/8 steps found)
- superpathway of arginine and polyamine biosynthesis (12/17 steps found)
- spermine biosynthesis (1/2 steps found)
- spermidine biosynthesis III (2/4 steps found)
- aminopropylcadaverine biosynthesis (1/3 steps found)
- superpathway of polyamine biosynthesis I (4/8 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.1.50
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (261 amino acids)
>LRK55_RS11320 adenosylmethionine decarboxylase (Rhodanobacter denitrificans MT42) MVKPLPRLRLQGFNNLTKALSFNIYDICYAVSEDQRQRYIEYIDEQYDADRLTQILTDVA EIIGANILNVARQDYDPQGASVTILISEEPVVEKLGRDSIAGAVVAHMDKSHITVHTYPE THPHNGIATFRADIDVATCGVISPLKALNYLIDSFESDIVVCDYRVRGFTRDVKGKKHFI DHKINSVQDYLAKHIRQKYEMFDVNVYQENMFHTKMHIKDFDLDTYLFESHADDLSFKER QRIESLLRREIEELFHGRNLM