Protein Info for LRK55_RS10565 in Rhodanobacter denitrificans MT42

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00702: Hydrolase" amino acids 7 to 184 (178 residues), 104.4 bits, see alignment E=2.1e-33 PF12710: HAD" amino acids 9 to 181 (173 residues), 39.9 bits, see alignment E=1.3e-13 PF13419: HAD_2" amino acids 9 to 184 (176 residues), 96.1 bits, see alignment E=5.6e-31 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 78 to 186 (109 residues), 32.8 bits, see alignment E=7.1e-12 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 98 to 184 (87 residues), 29.4 bits, see alignment E=9.3e-11 PF13242: Hydrolase_like" amino acids 147 to 203 (57 residues), 38.2 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: None (inferred from 74% identity to bph:Bphy_5294)

Predicted SEED Role

"2-deoxyglucose-6-phosphate phosphatase 1 (EC 3.1.3.68)" (EC 3.1.3.68)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>LRK55_RS10565 HAD family hydrolase (Rhodanobacter denitrificans MT42)
MPRHETAFLFDLDGTLIDSVYQHVLAWKEALDREGVELSVWRIHRKIGMSGGLFANILLR
ETGLEITAERLDRLRQWHAEAFNRQHAQGSVRPLPGARALLDYLTEQQIPWAIATSGRME
TAAPNLQALGVDPSKVPVVTRDQVRHAKPDPDLFLAAAARLGVDIQQSLVIGDSVWDMLA
AQRARALGVGLLSGGYGHAELQQSGAFRVYGDPADLLRHVDEVAARD