Protein Info for LRK55_RS09720 in Rhodanobacter denitrificans MT42

Annotation: glycosyltransferase family 39 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 127 to 153 (27 residues), see Phobius details amino acids 170 to 197 (28 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details amino acids 331 to 351 (21 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 403 to 420 (18 residues), see Phobius details amino acids 429 to 449 (21 residues), see Phobius details PF13231: PMT_2" amino acids 70 to 206 (137 residues), 38.4 bits, see alignment E=7.8e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (576 amino acids)

>LRK55_RS09720 glycosyltransferase family 39 protein (Rhodanobacter denitrificans MT42)
MSLSPSYSRYEQLRAVWPWLPLWAAVALLAIFSHGPMPLYSTRTLAVAWEMWNQGHWLVP
HINGQPYSEKAPLLFWLIHAGWFAFGVSDAWPRVLEVLVGGAQLVLASLLARRLFPDRPW
MAKATPWMLLAFGYAFLFGLQIMYDVLLATWALAALLCLTPRMQRAEPRWLLFGVCVGLG
LLTKGPVMLLHVAFPWLLGPLWNDWADRHRARWYGRGALALLLGGAMLLAWALPAGLSGG
EAYRQRLFFTQTAGRVVDKLAAGKDLQNHAEPFWFYLLWLPLMLFPFSGWPRIWVAVASL
RRPLEPGLRFALCWLLPTFVVFSLISGKQLYYPLPELAGAALLMAGAIAVLRERRPHLAD
NGWLGTWPLGVGGIAFAVALFMLPLLVASNRLHGEWVDSAAPYSRYFSVVFLLLGGLLLL
RGRGELRRLAVAGLIGVLALNALFTLTLWSRYDLRPIAHLLGAAEQAGHPLAYTGNYEGQ
FHFEGRLTRPISELFGDQAIQDFARAHPDGVIVLHVHRPDANDLRYALLAQPFRSSWLVA
WPAVSLADLRSGHTPPEPTQPTRVYPADDWRYRTQP