Protein Info for LRK55_RS09710 in Rhodanobacter denitrificans MT42

Annotation: DUF6159 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 52 (27 residues), see Phobius details amino acids 69 to 96 (28 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details PF19656: DUF6159" amino acids 69 to 268 (200 residues), 211.7 bits, see alignment E=5.6e-67

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>LRK55_RS09710 DUF6159 family protein (Rhodanobacter denitrificans MT42)
MAGKFARSWALLKASAAVLRSDKSLLVFPLLSGLCTLLVAASFLVPVGLMVIGGGHAGQR
FEQGMTAGAYLLMFGFYLVQYFVIVFFQTALTGVALMHLRGEPASVGAGFALARTRLPQI
LGYALIAATVGLLLRMIQERLGLIGRLVVGFIGLAWTVATFLVVPVLASEGTGPVDAVKR
SVELLKRSWGENLIGNGGIGVVFGLLMLLAVLLGAVLLGAAVVSQSAVAIVLAVAVVVLG
LTLLGLVQASLQGIYSAALYRYAEAGEASVGFDQALLQQAFAPKQR