Protein Info for LRK55_RS09595 in Rhodanobacter denitrificans MT42

Annotation: TatD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF01026: TatD_DNase" amino acids 5 to 260 (256 residues), 240.1 bits, see alignment E=1.3e-75

Best Hits

Swiss-Prot: 52% identical to TATD_PANVC: 3'-5' ssDNA/RNA exonuclease TatD (tatD) from Pantoea vagans (strain C9-1)

KEGG orthology group: K03424, TatD DNase family protein [EC: 3.1.21.-] (inferred from 66% identity to xcv:XCV0322)

MetaCyc: 51% identical to 3' -> 5' ssDNA/RNA exonuclease TatD (Escherichia coli K-12 substr. MG1655)
3.1.13.-; Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Deoxyribonuclease TatD" in subsystem Twin-arginine translocation system or YcfH

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.1, 3.1.21.-

Use Curated BLAST to search for 3.1.11.1 or 3.1.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>LRK55_RS09595 TatD family hydrolase (Rhodanobacter denitrificans MT42)
MPLLDIGANLTHESFHHDLDAVLQRAQAHGVMRMVVTGASREGSEHALALAKAHPGTLFA
TAGVHPHHALDYDDATDAALRELALQPQVRAVGETGLDYNRNYSPREVQLRVFERQLRIA
AELQMPLFLHQRDAHADFVALLRRWRDRVPAAVVHCFTDTGEALADYLALDCHIGITGWI
CDERRGAHLRELVRTIPANRLMIETDAPYLLPRTVRPPPSHRRNEPMYLKHICEEIARDR
GESAEVTAANSTATAEAFFGLA