Protein Info for LRK55_RS09410 in Rhodanobacter denitrificans MT42

Annotation: MMPL family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 770 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 245 to 262 (18 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 412 to 432 (21 residues), see Phobius details amino acids 631 to 650 (20 residues), see Phobius details amino acids 657 to 677 (21 residues), see Phobius details amino acids 683 to 703 (21 residues), see Phobius details amino acids 716 to 738 (23 residues), see Phobius details amino acids 744 to 764 (21 residues), see Phobius details PF03176: MMPL" amino acids 169 to 410 (242 residues), 35.4 bits, see alignment E=3.1e-13

Best Hits

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (770 amino acids)

>LRK55_RS09410 MMPL family transporter (Rhodanobacter denitrificans MT42)
MRARATLLLAWLLALAGLGWMVSQRLHVSTDLRSFMPAPTTPDQRLLMEQVGEGPGSRLL
LLSIRGQSDTQLAALSQGLAAALKNDRRYSQVLNGSFDLGALDGRLLPYRYLLSPALDTQ
PLDEAYLADQLQQRLDDLSSPAASLLKGLLPRDPTLEVLKLAELWAPAKSPELREGVWFS
PQGEALLLVQTVAAGFDPGAQQQAIDGIRHAFAALPGSAGAKLELSGPGYFSVVVGAQTR
HQADWIGRISTVGFVALLLLAYRSVGSLLLSALPIASAALAGIAALTLAFPAVHGITLAF
GFTLLGVAQEYPIRVLSHRRAGEDALASVRALWPLLLTAIASACIAYLAFYASGVNGLKQ
LAVFTIVGLLVAGFSTRYLLPQLLPRRVRDVAGMRWLMRARSFVDRLPRPRWIPGVVAVA
IVAMLALARGPFWQDNLAALTPLPADLLQHDARLREALGAPDVRYLLVLEAPTEQGVLAL
SEQLQPRVDALLARHAVDALELPSRYLPSVAVQRARQAKLPDRGTLQHALDEASRGLPFR
ADLFRPFADDVQAARTLPPLTPQRYAQTPLGQRLAAMLVERDGHWLGLGTVSGVHDVAAL
QALGTNTNGTVRLLDLKAASESLVVDYRTRILQALLAAAVLLVLTITFALRSVRRTWHVL
APMTLATFLVLAVERVAGIEISLFHLVALILAGGLGLHYALFFERDTGDPAEQRRTLHAT
LVCVLSALLVFGMLAWATIPVLRAIGLTVSLGVAFHFCLSILMAPHAAED