Protein Info for LRK55_RS08785 in Rhodanobacter denitrificans MT42

Annotation: glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00117: GATase
  • amino acids 58 to 195 (138 residues), 65.3 bits, E=5.9e-22
• PF07722: Peptidase_C26
  • amino acids 79 to 187 (109 residues), 32.9 bits, E=5.9e-12

Best Hits

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 54% identity to psu:Psesu_2961)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (242 amino acids)

>LRK55_RS08785 glutamine amidotransferase (Rhodanobacter denitrificans MT42)
MKPVLIVRTGRAPNPIRARHGDFPHWFRLGAGLHPRQLQVIDVAAGEALPAPREVAGAII
TGSAAMVTERSTWSERTAGWIRDAMDIELPLFGVCYGHQLMAHALGGRVDYLPGGREIGT
QTIEVSMLATRDPLAASLPARFRAHTTHEQSVVEPPDGATVLARSTRDPHQLLRYGPHAL
SVQFHPEFNAEVMRAYIRRKQADLRLEGADPEKIFSAVAATPIARQLLRRFSRHHHWAVA
AG