Protein Info for LRK55_RS07620 in Rhodanobacter denitrificans MT42

Annotation: TlpA disulfide reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details PF08534: Redoxin" amino acids 135 to 253 (119 residues), 51.2 bits, see alignment E=3.1e-17 PF00578: AhpC-TSA" amino acids 136 to 246 (111 residues), 53.6 bits, see alignment E=5.6e-18 PF13098: Thioredoxin_2" amino acids 154 to 260 (107 residues), 27.2 bits, see alignment E=1e-09 PF13905: Thioredoxin_8" amino acids 156 to 243 (88 residues), 31.9 bits, see alignment E=3.5e-11

Best Hits

KEGG orthology group: None (inferred from 46% identity to rme:Rmet_2395)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>LRK55_RS07620 TlpA disulfide reductase family protein (Rhodanobacter denitrificans MT42)
MNIGPLALSSALLALLFGVVAALAVAGFLARRGYADAGNALYLALGVGLLTARIAYVVGW
WPQYVQQPLSMLNIRDQGFDPIAGALGLLAAATLIGWRRPPLRRPLAAGVAVGIAAWAFA
GLLAYKLTAASHPGLPALALRDLDGREVSLQTLRGQPSVINLWATWCGPCRREMPVLAEA
QRTMPQIRFVFADQGESAAAVKQFMQVQRLALDDVLIDGNLDLSNHYNARGYPTTLFLDA
DGRLRDMHIGELSRATLAERLQRITPPAAAPR