Protein Info for LRK55_RS07470 in Rhodanobacter denitrificans MT42

Annotation: FAD/NAD(P)-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 3 to 306 (304 residues), 61.5 bits, see alignment E=4.8e-21

Best Hits

Swiss-Prot: 56% identical to SQRD_ACIF2: Sulfide-quinone reductase (AFE_1792) from Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 63% identity to tbd:Tbd_2225)

MetaCyc: 57% identical to sulfide:quinone oxidoreductase (Rhodobacter capsulatus)
R17-RXN [EC: 1.8.5.4]

Predicted SEED Role

"FAD-dependent pyridine nucleotide-disulphide oxidoreductase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.8.5.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>LRK55_RS07470 FAD/NAD(P)-binding oxidoreductase (Rhodanobacter denitrificans MT42)
MANIIILGAGLGGMSAAYEIRDTVGSEHAITVVGEGPQFNFTPSNPWVAVGWRGQDEIRV
DVAQPLARRDIHFIDASASKVRPADNRIELGDGRTLDYDYLVITTGPRLAFERVPGSGPD
GFTQSICTGPHAHRAWLAYQEFLKHPGPIVIGAAQGASCFGPAYEFAMIVDTDLRRRKLR
DRVPMTYVSAEPYIGHMGLGGIGDSKGLLESELRQRHIKWITNARVTSVESGKMHVEQLD
ERGQLQQQHELPFAFSMLLPSFAGVDAVKDVEGLVNPGGFVLIDEFQRNPSYPNVYAAGV
CVAIPPVEVTPVPTGAPKTGLMIESMVTAIAHNLRDAIAGRPPHARATWNAMCLADMGDR
GFAFIALPQIPPRNVTKAMTGKWVHLAKVAYEKYFLRKMRKGQADPIYEKTIMEAFGIDR
LKPDVKADETPAP