Protein Info for LRK55_RS07040 in Rhodanobacter denitrificans MT42

Annotation: pteridine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 9 to 190 (182 residues), 130.5 bits, see alignment E=8.4e-42 PF08659: KR" amino acids 10 to 127 (118 residues), 27.4 bits, see alignment E=4.5e-10 PF13561: adh_short_C2" amino acids 14 to 244 (231 residues), 161.5 bits, see alignment E=4e-51

Best Hits

KEGG orthology group: K03793, pteridine reductase [EC: 1.5.1.33] (inferred from 63% identity to xal:XALc_0833)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>LRK55_RS07040 pteridine reductase (Rhodanobacter denitrificans MT42)
MPPRHDRPVALITGASRRVGAVTARTLHAAGYDLALHYRCSGDDARALADELERRRGGST
LLLQAELADLPALPALLEQLLAHYGRLDALVNNASAFFPTPLGTATPAQWNTLFASNAQA
PFFLSQAAIPALREARGGIVNLVDIYAERPLAQHTVYCMAKAALAAMTRSLALELAPHIR
VNGVAPGAVLWPSDGKPYADQQAMLARTPLQRAGTPEDVAGAVLWLLRDAPYVTGQVIRV
DGGRTLSV