Protein Info for LRK55_RS05290 in Rhodanobacter denitrificans MT42

Annotation: sulfate adenylyltransferase subunit CysD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02039: sulfate adenylyltransferase, small subunit
  • amino acids 12 to 305 (294 residues), 496.9 bits, E=1.2e-153
• PF01507: PAPS_reduct
  • amino acids 33 to 259 (227 residues), 186.4 bits, E=2.3e-59

Best Hits

Swiss-Prot: 76% identical to CYSD_XANOP: Sulfate adenylyltransferase subunit 2 (cysD) from Xanthomonas oryzae pv. oryzae (strain PXO99A)

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 78% identity to psu:Psesu_0468)

MetaCyc: 67% identical to sulfate adenylyltransferase subunit 2 (Escherichia coli K-12 substr. MG1655)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (8/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• assimilatory sulfate reduction II (1/3 steps found)
• sulfite oxidation III (1/3 steps found)
• selenate reduction (2/5 steps found)
• dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (3/12 steps found)
• superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Protein Sequence (305 amino acids)

>LRK55_RS05290 sulfate adenylyltransferase subunit CysD (Rhodanobacter denitrificans MT42)
MNIDNIPARSHLDDLEAESIHIFREVAASFRHPVMLYSIGKDSSVLLHLLRKAFYPAKPP
LPLLHVDTTWKFREMIAFRERVAASGDVQVLVHINQDGVRQGISPLTHGATVHTDVMKTQ
ALKQALDQYGFDAAIGGARRDEEKSRAKERVFSFRNGQHRWDPKRQRPEFWHTYNTQIRQ
GESVRVFPLSNWTEMDVWLYIRREGIPVVPLYFAAPRPVVARDGALIMVDDERFTLREGE
AVEMREVRFRTLGCYPLTGAVASSADTLDKIIAEMADSRSSERQGRVIDHDPTASMERKK
LEGYF