Protein Info for LRK55_RS04860 in Rhodanobacter denitrificans MT42

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 transmembrane" amino acids 31 to 56 (26 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 289 to 306 (18 residues), see Phobius details PF00664: ABC_membrane" amino acids 77 to 282 (206 residues), 39.1 bits, see alignment E=7.4e-14 PF00005: ABC_tran" amino acids 371 to 515 (145 residues), 60.3 bits, see alignment E=3.3e-20

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 58% identity to xcv:XCV1737)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>LRK55_RS04860 ABC transporter ATP-binding protein (Rhodanobacter denitrificans MT42)
MPDEPSPAQGHTLDLLRSLARTLGGSDLAEIAAYVALSLAAALVGSLAAVLLVPLVQPGH
ALQLAGGMFDVGGGVEMRAAVFVAATAAFAVLRWLVAWLGARLTSRYGMTRRRLVHARLV
DAPLASLADATSAEIANVLTYNVETLTQGFAALLQLLVAGITTIVSLGFAFWVSPPLMLT
APLLAGFALVASRIFGREQSQVGRRYVADMTRLFWLSEDFPRRLRHIRSFGRGDAEKESY
GAISAALGHGYRRQLELVAAGRLVLELLAAAAIAAVLVLAYRWHGVDPSSLIAVCLLLGR
LLPYLVSTRQSFQQLRSAVPAFGLWQRYMDLDTIRSPATPSPAGPGTDRPALHIERIRLA
PPLAGLDVRQVSLRPGELTLIRGDSGIGKSSLVDVLAGMGVPGVFAARVDGHAIGFGEYR
ELVRHGAYVSQGVRPWQHSVRECLRWAAPEAGAELMQAALQDVGLDRRLAGSLQGLDTAL
HSTASRLSGGELQRLLLAQVILRRPFLAVLDEATSALDAASEIQVLAAMKRRLPQTILVV
VSHRASVAAVADQCLSIDGDLVATMTASADPCRAAALEHGGRPHDGAR