Protein Info for LRK55_RS04675 in Rhodanobacter denitrificans MT42

Annotation: tol-pal system-associated acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 TIGR02799: tol-pal system-associated acyl-CoA thioesterase" amino acids 10 to 134 (125 residues), 168.4 bits, see alignment E=7.9e-54 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 14 to 129 (116 residues), 113 bits, see alignment E=1e-36 PF13279: 4HBT_2" amino acids 16 to 133 (118 residues), 80.3 bits, see alignment E=1.6e-26 PF03061: 4HBT" amino acids 24 to 107 (84 residues), 58.1 bits, see alignment E=9.2e-20

Best Hits

Swiss-Prot: 49% identical to YBGC_HAEIN: Acyl-CoA thioesterase YbgC (ybgC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 56% identity to xom:XOO_1548)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>LRK55_RS04675 tol-pal system-associated acyl-CoA thioesterase (Rhodanobacter denitrificans MT42)
MPESAPEPPFSWNVRVYWEDTDAGGVVYHAGYLRFMERARSEWMRALGVDQMAFKQATGL
AFMVRDMHIDFLRPALLDDELSVTVEVKERRAASILFAQTITKKDGSCLIRASVRVACVD
LQRMRPAPIPADLIPQPAPQDNPSR