Protein Info for LRK55_RS04610 in Rhodanobacter denitrificans MT42

Annotation: PilW family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF07963: N_methyl" amino acids 5 to 29 (25 residues), 26.4 bits, see alignment (E = 3.7e-10) TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 7 to 28 (22 residues), 20 bits, see alignment (E = 2.2e-08) PF16074: PilW" amino acids 206 to 352 (147 residues), 75.8 bits, see alignment E=3.2e-25

Best Hits

KEGG orthology group: K02672, type IV pilus assembly protein PilW (inferred from 48% identity to reu:Reut_A0402)

Predicted SEED Role

"Type IV fimbrial biogenesis protein PilW" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>LRK55_RS04610 PilW family protein (Rhodanobacter denitrificans MT42)
MSHARQQAGMSLIELMIAIAIGLALLAGLSSLYVSTSKARTEFNKTSEQVENGRFALQSI
TRDIEMAGFYGRASQLIATSSYALPDPCAAAPASMGFSTTPTVTVPLPVYGPALAATVLP
CLATTLPNRATGAEVLTVSYVAGTTTAAANGTDYYVQRSGCETDSVPLVYSKTAADFTLH
NKAAVAGGTCSTSSAAELRKYVMRSYYVATCDVCSGAGADTTPTLKMAEFVNGTIQTSSL
VTGIEDVHYSYGMDLDNNGSPDCYADNPSDTSAVPAACATAATAASYAWTASATANWANV
AAVRINLLSRNLDSTASWTDTRTYALGRAAANGPYGDHYKRHIYGTVARIWNTGGLRENQ