Protein Info for LRK55_RS04245 in Rhodanobacter denitrificans MT42

Annotation: 3-oxoadipyl-CoA thiolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02430: 3-oxoadipyl-CoA thiolase
  • amino acids 3 to 399 (397 residues), 628.5 bits, E=4.8e-193
• PF00108: Thiolase_N
  • amino acids 6 to 267 (262 residues), 238.1 bits, E=1.7e-74
• TIGR01930: acetyl-CoA C-acyltransferase
  • amino acids 7 to 398 (392 residues), 434.5 bits, E=3.4e-134
• PF00109: ketoacyl-synt
  • amino acids 82 to 121 (40 residues), 29.1 bits, 1.1e-10
• PF02803: Thiolase_C
  • amino acids 275 to 399 (125 residues), 138.4 bits, E=1.4e-44

Best Hits

Swiss-Prot: 65% identical to PCAF_PSEAE: Beta-ketoadipyl-CoA thiolase (pcaF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07823, 3-oxoadipyl-CoA thiolase [EC: 2.3.1.174] (inferred from 65% identity to pfl:PFL_1319)

MetaCyc: 61% identical to subunit of beta-ketoadipyl CoA thiolase (Pseudomonas putida)
3-oxoadipyl-CoA thiolase. [EC: 2.3.1.174]; Acetyl-CoA C-acyltransferase. [EC: 2.3.1.174, 2.3.1.16]

Predicted SEED Role

"3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9)" (EC 2.3.1.16, EC 2.3.1.9)

MetaCyc Pathways

• oleate β-oxidation (32/35 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (9/10 steps found)
• adipate degradation (5/5 steps found)
• fatty acid β-oxidation I (generic) (6/7 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (6/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• ketolysis (3/3 steps found)
• fatty acid salvage (5/6 steps found)
• 3-oxoadipate degradation (2/2 steps found)
• adipate biosynthesis (4/5 steps found)
• isoprene biosynthesis II (engineered) (6/8 steps found)
• L-tryptophan degradation III (eukaryotic) (11/15 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• polyhydroxybutanoate biosynthesis (2/3 steps found)
• L-isoleucine degradation I (4/6 steps found)
• catechol degradation III (ortho-cleavage pathway) (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• acetoacetate degradation (to acetyl CoA) (1/2 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• ketogenesis (3/5 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• mevalonate pathway II (haloarchaea) (4/7 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• superpathway of salicylate degradation (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• 5,6-dehydrokavain biosynthesis (engineered) (6/10 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• aromatic compounds degradation via β-ketoadipate (5/9 steps found)
• valproate β-oxidation (5/9 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (2/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• mevalonate pathway IV (archaea) (4/8 steps found)
• 4-methylcatechol degradation (ortho cleavage) (3/7 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• glycerol degradation to butanol (9/16 steps found)
• ethylbenzene degradation (anaerobic) (1/5 steps found)
• fatty acid β-oxidation VII (yeast peroxisome) (1/5 steps found)
• isopropanol biosynthesis (engineered) (1/5 steps found)
• pyruvate fermentation to acetone (1/5 steps found)
• mevalonate pathway III (Thermoplasma) (3/8 steps found)
• pyruvate fermentation to butanol I (3/8 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (5/11 steps found)
• toluene degradation III (aerobic) (via p-cresol) (5/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• 9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (4/10 steps found)
• 10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
• 4-ethylphenol degradation (anaerobic) (1/6 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• phenylacetate degradation I (aerobic) (3/9 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)
• 2-deoxy-D-ribose degradation II (2/8 steps found)
• 2-methylpropene degradation (2/8 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• methyl tert-butyl ether degradation (3/10 steps found)
• 4-oxopentanoate degradation (2/9 steps found)
• ethylmalonyl-CoA pathway (3/11 steps found)
• superpathway of phenylethylamine degradation (3/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (4/13 steps found)
• 10-cis-heptadecenoyl-CoA degradation (yeast) (2/12 steps found)
• 10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (2/12 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• mandelate degradation to acetyl-CoA (5/18 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• jasmonic acid biosynthesis (4/19 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• androstenedione degradation I (aerobic) (8/25 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
• superpathway of ergosterol biosynthesis I (8/26 steps found)
• sitosterol degradation to androstenedione (1/18 steps found)
• superpathway of testosterone and androsterone degradation (8/28 steps found)
• platensimycin biosynthesis (6/26 steps found)
• androstenedione degradation II (anaerobic) (6/27 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (2/22 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (11/35 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)
• superpathway of aerobic toluene degradation (6/30 steps found)
• superpathway of cholesterol biosynthesis (8/38 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (10/42 steps found)
• superpathway of L-lysine degradation (8/43 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (10/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (6/49 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Ethylbenzene degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Synthesis and degradation of ketone bodies
• Terpenoid biosynthesis
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.16, 2.3.1.9

Use Curated BLAST to search for 2.3.1.16 or 2.3.1.174 or 2.3.1.9

Protein Sequence (400 amino acids)

>LRK55_RS04245 3-oxoadipyl-CoA thiolase (Rhodanobacter denitrificans MT42)
MTSAWLVDATRTPFGRLGGALAGVRADDLAALPIAALMARHPTLDWAALDEVILGCANQA
GEDNRNVARMAALLAGLPQSVPAVTVNRLCASGLEAIGQAARAIACGEAELVVAGGVESM
SRAPYVLAKADVAYARGQQLEDTTLGWRLVNPRMQAGYGIDSMTQTAENLAREHGIDRDS
QDAYALRSQQRTAHAQAQGWLAEEITAVHAPHGKESLVVQVDEHPRADTTAAKLAALKPL
LGAGTSITAGNASGLNDGAAAVLLASEAALARYGLQPLARIVGMAAAGVAPRVMGIGPVP
AIHKLLARTGLGASDFDRIEINEAFAAQVLACTRSLGLPDDAEHVNANGGAIALGHPLGA
SGARLALSAAFALRRHRQHRALVSLCVGVGQGLALALERP