Protein Info for LRK55_RS03910 in Rhodanobacter denitrificans MT42

Annotation: inositol monophosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00459: Inositol_P" amino acids 10 to 254 (245 residues), 177.2 bits, see alignment E=2.5e-56

Best Hits

KEGG orthology group: None (inferred from 59% identity to tkm:TK90_2248)

Predicted SEED Role

"Histidinol-phosphatase [alternative form] (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.15

Use Curated BLAST to search for 3.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>LRK55_RS03910 inositol monophosphatase family protein (Rhodanobacter denitrificans MT42)
MNPDIAATALTAAREAAAAAAEVIEHYWRRGVEVELKSDATPVTIADREAEQAIRRVLQM
ALPQASIYGEEYGLDGERGGLLWLVDPLDGTKSFVRRTPFFSTQIALMDGDELVLGVSSA
PVYGETMWASAGNGAWFEGERVRVADTARLAQASISTGNVKTLTGDSRWDALGALIRDSN
RIRGYGDFCHYHLLARGSLDLVIESDVNILDIAALAVIVREAGGVFTDLDGAPPTLDTTS
VLAGTPAIHAQALQRLRR