Protein Info for LRK55_RS03645 in Rhodanobacter denitrificans MT42

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 664 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 157 to 173 (17 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 394 to 410 (17 residues), see Phobius details amino acids 420 to 442 (23 residues), see Phobius details

Best Hits

Predicted SEED Role

"TPR-repeat-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (664 amino acids)

>LRK55_RS03645 hypothetical protein (Rhodanobacter denitrificans MT42)
MTDFLRRSPWRLLALLAAFAITLIVYWPGLSGGFLFDDYPNIVDNKGVQPRDANFPSLVG
AALSSPASDFKRPLASLSFAINYLATGLDPYWMKLTNLLIHLLNGWLVYLLSLALLRSDS
SRQHPHAPLVAVLIAAGWMLLPINLTAVLYVVQRMESMANLFVLMGLFGYVTGRRRMLGL
RHAPPPASLGNAQWTGFILCIASTTIPTATGILAKETAVMLPLYALLIEWALFHFSQPQK
APILQEKHHIGFSRRHDLRLIGLFLVVFALPFVMGLAWLLPSVVKPAAWATRDFTLGTRL
LSEARIVTDYVAWTLLPTPNALSFYHDDFRISTGLLSPWSTLASVVFLTALTALMLWLRP
RKPVAALGIALFLGCQLLTGTILPLELIYEHRNYFASFGLLLAITPLLAVPRSQPFALPC
YVLLAGLLLSWTALTAMTAYVWGNPLRLAEDLALRAPQSPRAQYELGRTYIIYSHYDPAS
PFTKLAYTPLEKSASLPNSSILPEQALIFMNARMKLPLKDAWWDSMIAKLQTRRPGVQDE
SSLGALTQCAHEGRCDLPQQRMMNAFMASLAHPDPSARLLATYGDYAWNVLKDHALGERM
IEEAIKASPYEPAYQITLVRMLAAQGRMDEARQAILRLQKLNVGGRLDEELGALRMRLGS
PSHG