Protein Info for LRK55_RS03060 in Rhodanobacter denitrificans MT42

Annotation: acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase
  • amino acids 2 to 255 (254 residues), 333.1 bits, E=4.7e-104
• PF00132: Hexapep
  • amino acids 12 to 46 (35 residues), 36.8 bits, 2.1e-13
  • amino acids 30 to 64 (35 residues), 31.6 bits, 9.7e-12
  • amino acids 103 to 135 (33 residues), 36.2 bits, 3.2e-13
• PF13720: Acetyltransf_11
  • amino acids 174 to 255 (82 residues), 89.5 bits, E=1.5e-29

Best Hits

Swiss-Prot: 68% identical to LPXA_STRMK: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 68% identity to sml:Smlt1495)

MetaCyc: 50% identical to acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase (Vibrio cholerae O1 biovar El Tor str. N16961)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (14/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Protein Sequence (257 amino acids)

>LRK55_RS03060 acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase (Rhodanobacter denitrificans MT42)
MIHPTALIDPSAVIGANVGIGAYSVIGAEVEIGDGTVIGPHVVIEGPTKIGRDNRIAQFA
SLGGAPQDKKWEGERTELVIGDRNLIREFTTLNRGTGHGGGVTRIGNDNWVLAYVHIAHD
CQIGNNVVFSNYSALAGHVTIGDWTILSGYSGVHQFCKVGAHAFIGMGCLVGHDVPPFVM
MANEQQGRPRGINSEGLKRRGFDATRIAAIKRAYRTLYMAGLPLPEAREKLVELARESDD
VRAMLEFLDHSERALAR