Protein Info for LRK55_RS03000 in Rhodanobacter denitrificans MT42

Annotation: type I methionyl aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 TIGR00500: methionine aminopeptidase, type I" amino acids 3 to 249 (247 residues), 329.9 bits, see alignment E=5e-103 PF00557: Peptidase_M24" amino acids 12 to 242 (231 residues), 181.7 bits, see alignment E=8.4e-58

Best Hits

Swiss-Prot: 63% identical to MAP1_ECO57: Methionine aminopeptidase (map) from Escherichia coli O157:H7

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 76% identity to xal:XALc_2020)

MetaCyc: 63% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>LRK55_RS03000 type I methionyl aminopeptidase (Rhodanobacter denitrificans MT42)
MAITLKSPADLEGMRVAGKLAAEVLAMLKEYVKPGVTTEELDRRAYEHIVNVQKAIPANV
GYHGFPKTLCTSVNHVICHGIPNEGKVLKDGDIVNLDVTVIKDGWHGDTSRMYIAGAPSV
LAKRLVDTTFEAMMRGIQAVRPGATLGDIGHAIQQHAEAAGFSVVREYCGHGIGKVYHDE
PQVLHYGKPGIGVELKKGMTFTIEPMINAGKPHTRQLPDGWTVVTKDHSLSAQWEHTIAV
TDDGFEILTPWPDA