Protein Info for LRK55_RS01480 in Rhodanobacter denitrificans MT42

Annotation: tRNA pseudouridine(38-40) synthase TruA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 2 to 236 (235 residues), 202.7 bits, see alignment E=3.3e-64 PF01416: PseudoU_synth_1" amino acids 8 to 102 (95 residues), 43.4 bits, see alignment E=2.1e-15 amino acids 142 to 244 (103 residues), 95.6 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 64% identical to TRUA_XANC5: tRNA pseudouridine synthase A (truA) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K06173, tRNA pseudouridine synthase A [EC: 5.4.99.12] (inferred from 64% identity to xcv:XCV2872)

MetaCyc: 54% identical to tRNA pseudouridine38-40 synthase (Escherichia coli K-12 substr. MG1655)
tRNA-pseudouridine synthase I. [EC: 5.4.99.12]

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>LRK55_RS01480 tRNA pseudouridine(38-40) synthase TruA (Rhodanobacter denitrificans MT42)
MRIALGIEYDGTNFSGWQRLKADVSVQGVLEEALSKVADHSVEVSCAGRTDAGVHGRCQV
VHFDTEARRDMRGWVLGSCSNLPASVAVLWAQPVPDSFHARYAARSRRYRYRLLNRPVRA
ALDARYVTWERLPLDAERMHAAAQALLGEHDFSAFRALSCQAAHPRRSVLAVGVRREGEQ
LFVDIEANAFLHHMVRNIVGSLLPIGRGEQPVEWMAELLAGCDRQVAGPTAPSSGLTFIG
PRYEAHWGLPPDVCLPGAGR