Protein Info for LRK54_RS17985 in Rhodanobacter denitrificans FW104-10B01

Annotation: 4-hydroxy-tetrahydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase
  • amino acids 5 to 262 (258 residues), 232.2 bits, E=4.2e-73
• PF01113: DapB_N
  • amino acids 6 to 124 (119 residues), 79.5 bits, E=2.4e-26
• PF05173: DapB_C
  • amino acids 127 to 262 (136 residues), 135.1 bits, E=1.6e-43

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.8

Use Curated BLAST to search for 1.17.1.8

Protein Sequence (266 amino acids)

>LRK54_RS17985 4-hydroxy-tetrahydrodipicolinate reductase (Rhodanobacter denitrificans FW104-10B01)
MTRPLRLALSGASGRMGRALLDLLGGDEHIELVHAVVAPGSVHDGQPVPGSAAGFLRYAH
DWLHAPPIDVVIDFSSPAALAHALDHCLAQGAALVSGTTGIDAALEARLADAARRIAILR
AANFSLGVAVLTRLLREAAAALPDWDLEIVEAHHGRKQDAPSGTALALGRAAAVARDTTL
EAAAVCSREGRTGERNEGSIGFAVVRGGDIVGEHTAMLIGQGERLELIHRATDRTILARG
ALHAAHWLAGRAAGSWQLDDMIAAPR