Protein Info for LRK54_RS16535 in Rhodanobacter denitrificans FW104-10B01

Annotation: VIT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details PF01988: VIT1" amino acids 17 to 224 (208 residues), 231 bits, see alignment E=7e-73

Best Hits

Swiss-Prot: 53% identical to PCL1_SCHPO: Fe(2+)/Mn(2+) transporter pcl1 (pcl1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 72% identity to eba:ebA544)

Predicted SEED Role

"Mlr6622 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>LRK54_RS16535 VIT family protein (Rhodanobacter denitrificans FW104-10B01)
MPRHHHERHRTDRIGWLRAAVLGANDGIVSTASLVLGVAAAHASGQNILVAGVAGLVAGA
MSMAAGEYVSVHSQADSERAELAREHLELQTQSEAEHRELAAIYVGRGLDPQLARQVAEQ
LMAHDALDAHARDELGITEVLKARPLQAAGASALSFAVGSALPLLVVALTPAASLLWLVF
ATSLVFLAVLGAVAAWAGGAKMGVGAMRITFWGALAMAITTGVGMLFGTAA