Protein Info for LRK54_RS16245 in Rhodanobacter denitrificans FW104-10B01

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 33 to 176 (144 residues), 129.8 bits, E=1.2e-41

Best Hits

Swiss-Prot: 49% identical to Y352_THEMA: Uncharacterized ABC transporter ATP-binding protein TM_0352 (TM_0352) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K02003, (no description) (inferred from 76% identity to tgr:Tgr7_1479)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Protein Sequence (243 amino acids)

>LRK54_RS16245 ABC transporter ATP-binding protein (Rhodanobacter denitrificans FW104-10B01)
MAVVAPLPVGEAVFRASGLTKTYRMGEVEVHALRGIDLDLFRGEFVVLLGPSGSGKSTLL
NILGGLDAPTAGEVWYEGHHLTGATERELTRFRREHVGFVFQFYNLIPSLTARENVAIVT
EIAEQPMTPEEALARVDLADRMDHFPAQLSGGQQQRVAIARAIAKRPAVLLCDEPTGALD
SATGVRVLEALERVNAELGTTTVVITHNADIARMAHRVLYLGDGRVVREERPAQRTPAKE
LRW