Protein Info for LRK54_RS16165 in Rhodanobacter denitrificans FW104-10B01

Annotation: succinate dehydrogenase, cytochrome b556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01127: Sdh_cyt
  • amino acids 3 to 119 (117 residues), 119.2 bits, E=1.1e-38
• TIGR02970: succinate dehydrogenase, cytochrome b556 subunit
  • amino acids 4 to 122 (119 residues), 135.6 bits, E=5.1e-44
• PF02300: Fumarate_red_C
  • amino acids 23 to 81 (59 residues), 25.9 bits, E=9.4e-10

Best Hits

Swiss-Prot: 45% identical to DHSC_PARDE: Succinate dehydrogenase cytochrome b556 subunit (sdhC) from Paracoccus denitrificans

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 59% identity to xal:XALc_1826)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

Protein Sequence (131 amino acids)

>LRK54_RS16165 succinate dehydrogenase, cytochrome b556 subunit (Rhodanobacter denitrificans FW104-10B01)
MADKQRPLSPHLQVYRWQIQMVTSILHRATGIALAVGTLLVVWGILALASGEAAFEQFKT
CTGSPIGLILLVGWTWALGYHLCNGIRHLVQDTGAGYKIPQFVRSSWLSVIGSFVLTVII
WACVLAQGGAA