Protein Info for LRK54_RS15715 in Rhodanobacter denitrificans FW104-10B01

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 311 to 331 (21 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 365 to 383 (19 residues), see Phobius details amino acids 423 to 446 (24 residues), see Phobius details amino acids 465 to 487 (23 residues), see Phobius details PF04069: OpuAC" amino acids 31 to 286 (256 residues), 178 bits, see alignment E=2.8e-56 PF00528: BPD_transp_1" amino acids 323 to 492 (170 residues), 85.3 bits, see alignment E=4.5e-28

Best Hits

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 67% identity to xal:XALc_0692)

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1) / Osmotic adaptation" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>LRK54_RS15715 ABC transporter permease subunit (Rhodanobacter denitrificans FW104-10B01)
MMRRLLPAPMLLGVCLLLGACLLPAPAQAAPVRIGSKQFTESVILGELALAGAREAGVEA
VHRRELGGTRILWRALLDGEIDAYPEYTGTLTQELLKGLPANADIASLRAQLKPLGIGIT
DSLGFSDSYAIGMRSDVAARLGIADISDLLQHPGLRFGFSNEFMDRGDGWPGLRQRYGLP
QANVSGLDHALSYRALASGAVDAIDLYSTDAEIPYYHLRTLRDDRDYFPRYDAVYLYRLA
LEQSAPAFVGVLHKLVGSIDEDAMRAMNARVKLRGVKENVVAADFLGIHADGHDGGLWPH
LLQRSVEHVKLVAISLGLAILLAIPLGILAARRRRLGQWLIGLTGVLQTVPSLAMFVFMI
PLLGIGTWPAIAALFLYSLLPIVRNTHAGLVGIAPELRESAAALGLPPGVRLRRVELPLA
LRSILAGIKTAAVINVGTATLAALIGAGGYGQPILTGIRLDDVGLILQGAVPAAVLALLV
QGLFELVERRLTPRGLRLEARQ