Protein Info for LRK54_RS15065 in Rhodanobacter denitrificans FW104-10B01

Annotation: aspartyl/asparaginyl beta-hydroxylase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 45 to 56 (12 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details PF05118: Asp_Arg_Hydrox" amino acids 75 to 229 (155 residues), 174.1 bits, see alignment E=1e-55

Best Hits

KEGG orthology group: K12979, beta-hydroxylase [EC: 1.14.11.-] (inferred from 60% identity to pfo:Pfl01_1414)

Predicted SEED Role

"Fe(2+)/alpha-ketoglutarate-dependent dioxygenase LpxO" in subsystem Lipid A modifications

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>LRK54_RS15065 aspartyl/asparaginyl beta-hydroxylase domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MILTPRLILLVLFAFFVLCVLLVHLRGRVRLRFDRQLVDHSAVFAPYNLLMYAFSAVPAK
PILDRRGFPELDLLQANWQTIRDEALQLTEAGHIRGTTKNDDASFNSFIKQGWKRFYLKW
YGEPLASAEALCPKTVALLNAIPGIKAAMFATLAPNSRLNPHRDPFAGSLRYHLGLITPN
SRDCRIFVDGEEHAWGDGKDVVFDETYVHWVENKTDQTRVILFADVERPLRTLWMSAVNH
RVGAFMGRITASPNSDAGTEKTGAINRLYAWSQHKGALHHWKAAFKRRHKKLYKAGKYAG
IVLLMWLVFLAPWPLFR