Protein Info for LRK54_RS12335 in Rhodanobacter denitrificans FW104-10B01

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 48 (17 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 118 to 142 (25 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 60% identity to xal:XALc_2758)

Predicted SEED Role

"Optional hypothetical component of the B12 transporter BtuM" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>LRK54_RS12335 hypothetical protein (Rhodanobacter denitrificans FW104-10B01)
MATSTTRRLAIFLGLALVMGVTRFHPSLLHHALWDASWGVFFLAGFWLRGQVRWAFPLLM
AEAVLVDYLVISGQGIDFWSHYCVSPAYWFLVPSYGALWLGGSWLAKHQQGLDLRTLGLA
AGALLVAEGVCYLVSNGSFYWISASVPLPRSTASWFANLGDWYLPFLAGTAVYVALGALL
HVLATQLTHAAQRSGHPRH