Protein Info for LRK54_RS12310 in Rhodanobacter denitrificans FW104-10B01

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 5 to 321 (317 residues), 403.8 bits, see alignment E=3.2e-125 PF04166: PdxA" amino acids 32 to 318 (287 residues), 355.9 bits, see alignment E=8.6e-111

Best Hits

Swiss-Prot: 60% identical to PDXA_CHRVO: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 59% identity to mei:Msip34_0577)

MetaCyc: 55% identical to 4-hydroxythreonine-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
4-hydroxythreonine-4-phosphate dehydrogenase. [EC: 1.1.1.262]

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>LRK54_RS12310 4-hydroxythreonine-4-phosphate dehydrogenase PdxA (Rhodanobacter denitrificans FW104-10B01)
MPLPRLALTAGEPAGVGPELLVRLATTPLAATLVAITDRHLLQRAAARCGLAVELADDDG
SAPPMRRPGTLRVQHIPLAVDEVPGRPDPRNARHVLDTLAEAADGCMAGRYDAVVTAPLQ
KASINDAGVRFSGHTEFFAERAHADVVMMLASPELRVALATTHLPLAAVPAAITPAALTR
TLRIVHGELQRKFGIAAPRVAVLGLNPHAGEGGHLGHEEIDTVIPVLDALRGEGMHLLGP
LPADTAFVPAQRARYDAVLAMYHDQALPVLKSEAFDRTVNLTLGLPFIRTSVDHGTALDL
AGSGRADPASLIAAANMALELVARCATHPSSPRRGEERGEGPPPPETNR