Protein Info for LRK54_RS12225 in Rhodanobacter denitrificans FW104-10B01

Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 21 to 69 (49 residues), 36.2 bits, 9.3e-13
• TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  • amino acids 27 to 442 (416 residues), 463.6 bits, E=3.1e-143
• PF08245: Mur_ligase_M
  • amino acids 103 to 290 (188 residues), 163.1 bits, E=1.3e-51
• PF02875: Mur_ligase_C
  • amino acids 310 to 366 (57 residues), 36.7 bits, 6.3e-13

Best Hits

Swiss-Prot: 47% identical to MURF_ECOLI: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (murF) from Escherichia coli (strain K12)

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 54% identity to smt:Smal_0599)

MetaCyc: 47% identical to D-alanyl-D-alanine-adding enzyme (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase. [EC: 6.3.2.10]

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (10/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (6/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (10/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (11/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (11/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (10/17 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Protein Sequence (460 amino acids)

>LRK54_RS12225 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase (Rhodanobacter denitrificans FW104-10B01)
MMQLAAIALWTHGRLLGSDVEVTGVAIDTRRLEPGDLFVAIKGERADGHDYLAEAATRGA
VAALVTRKVDSALPQVLVGSTELALGDLASAVRAQRNVRVVGITGSNGKTTVKTLVASIL
SRHGRTHVSAGNFNNELGLPLSLLAMPPDTEYAVFEMGAGKPGDIAYLAAIARPDIGLVT
LIAPAHLARMGSIEGVAETKGALYQALPADGVAIINADDAFASFFTGLAGTRKVLRFGLE
QPADIGAGIVEQRVDGSRFVLHTPQGDAGVALPLPGRHNIANALAATAVALALEVPLATI
VAGLEQVPGVAGRLRRETMAGGWTLIDDSYNANPGSMAAAIDTLLLAAGERWLVLGDMAE
LGTDAPALHAGIGTRARERGVERLFAVGPFGTATVEAFGAGGTHFDDKVALIAALRTQLH
AGVTCLVKGSRSAGMEQVVAALGGHPGTAGKNEGGASDAA