Protein Info for LRK54_RS11580 in Rhodanobacter denitrificans FW104-10B01

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 27 (5 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details PF01925: TauE" amino acids 10 to 239 (230 residues), 125.1 bits, see alignment E=1.8e-40

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 57% identity to smt:Smal_3716)

Predicted SEED Role

"Sulfate transporter, CysZ-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>LRK54_RS11580 sulfite exporter TauE/SafE family protein (Rhodanobacter denitrificans FW104-10B01)
MDYGQFFVFAGVGLLAQLVDGALGMAYGLVSNSILLALGLPPAVASATVHTAEVFTTGVS
GAAHAWFGNVRWKLFWQLAIPGAIGGILGATFLASVPGEAIRPWVNAYLLILGTMVLLRA
FGQRLSRHRVQHSGVLGFFAGLLDAIGGGGWGPLATSTLIARGGGVRSTIGSVNAAEFVV
TVCVSATLVWHVGAGHWPIVLGLLTGGVIAAPLAAWLVHHLPEQAVMAAVGSLIVLISLG
QLAQTLL