Protein Info for LRK54_RS11565 in Rhodanobacter denitrificans FW104-10B01

Annotation: anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02885: Glycos_trans_3N
  • amino acids 11 to 72 (62 residues), 59.4 bits, E=2.3e-20
• TIGR01245: anthranilate phosphoribosyltransferase
  • amino acids 14 to 341 (328 residues), 409 bits, E=8e-127
• PF00591: Glycos_transf_3
  • amino acids 83 to 332 (250 residues), 302.8 bits, E=2.3e-94

Best Hits

Swiss-Prot: 75% identical to TRPD_XANAC: Anthranilate phosphoribosyltransferase (trpD) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 75% identity to xac:XAC0480)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (40/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Protein Sequence (350 amino acids)

>LRK54_RS11565 anthranilate phosphoribosyltransferase (Rhodanobacter denitrificans FW104-10B01)
MSARAITITPQEALQRTIEHREIFHDEMIALMRQIMRGEVSPLMTAAIITGLRVKKETVG
EITGAARVMRELSAKVDVPAHAHFVDIVGTGGDGASSFNISTTAMFVAAAAGACIAKHGG
RSVSSKSGSADVLEALGAAIELPPAQVAACMAETGIGFMFAPNHHPAMKVVAPVRKEMGV
RTLFNILGPLTNPAGAPNILMGVFHPDLVGIQVRVLQQLGARHALVVWGRDGLDEISLGA
ATLVGELRDGVVREYEVEPEDFGLAMASSRNLRVENAHESKAMLLEVLQGRHGVAHDIVC
LNAGAALYTADVATSVGEGIDLARATIASGAAHAKMQAFVAATRRLANPP