Protein Info for LRK54_RS10715 in Rhodanobacter denitrificans FW104-10B01

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 726 transmembrane" amino acids 25 to 51 (27 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 283 to 452 (170 residues), 121.7 bits, see alignment E=1.3e-39 PF00990: GGDEF" amino acids 287 to 448 (162 residues), 139.3 bits, see alignment E=9.9e-45 PF00563: EAL" amino acids 472 to 707 (236 residues), 239.5 bits, see alignment E=3.5e-75

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (726 amino acids)

>LRK54_RS10715 EAL domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MIDDYASAARTWGEGMLIGADPSAFGYFIAALIATTGIAFASGVQFVVIGLWRRREAVYL
SYAALCLCIAVLALGNMRLARADGLAAATAALHWMIAAAIASFAPMVVFIRAYTGAGTRW
RLLLAMSLLMVVLLCVNGSAPATLFFSRLEPGQAIVLPWGERLYRVSGAASAWGLAFHVA
SYAVFLWALGRAWAQYRGGDTLRAVLLGGCLIVQFVVLLWGDIMVDLLGYQAPYLDAFAF
LPFVLLMSLSLAAQMRRRTAQLEHTRRQLEVEEHTRHAAEQNLRHLAYHDSLTGLPNRAC
ALKRLAESRADALARGVCGALLLIDLDNFKTINDGLGHHVGDRLLQAMAERLLAAAPPEA
TLARLGGDEFVLMLGLRERTPSEVQARAERVAQDVIALVSEPVMEGRHVLGVGASVGVAV
YPVGEVGVADLLRRADIALYRAKAAGRNTVRVFLPPMQQEADQRLRLERGLREALEQDRM
GTQFALHFQPQITAAGELLGAEALLRWHHPQLGEVAPEKFIPLAEETGLIHALGAWVVDE
ACAHLRAWDRDGIPHGGSLAVNVSAWQLVHPHYAARLVAQVHAAGVAPARLTLELTESAL
LQDFDGAQATLRRLAAAGFRLALDDFGVGYSSLNYLQHLPLDVLKIDRAFVSELQVEAGN
PLAGFIIDMAHRLGIVAVAEGVETAFQRQALEQMGCDALQGYLISRPVGDASFRRWVVAH
RHAPVS